Insert a sequence into a database, and loads a array of objects


Sample code :


public function parseaseqdb(DatabaseInterface $databaseManager)
{
    $databaseManager->recording("humandb", "GENBANK", "human.seq", "demo.seq");
    $oSequence = $databaseManager->fetch("NM_031438", "data/");
 
    return $this->render('default/parseseqdb.html.twig',
        ["sequence" => $oSequence]
    );
}

Result :

  • accession
  • sequence
    • primAcc : "NM_031438"
    • entryName : ""
    • seqLength : 3488
    • start :
    • end :
    • molType : "mRNA"
    • date : "29-DEC-2018"
    • source : "Homo sapiens (human)"
    • sequence : "aagactgcat ccggctccag gaaaagcgag tgggatatcc caatctttgg actgcatcct ggttgcctct actgtggtca cctttgggaa gaaatgtctt ctgtaaaaag aagtctgaag caagaaatag ttactcagtt tcactgttca gctgctgaag gagatattgc caagttaaca ggaatactca gtcattctcc atctcttctc aatgaaactt ctgaaaatgg ctggactgct ttaatgtatg cggcaaggaa tgggcaccca gagatagtcc aatttctgct tgagaaaggg tgtgacagat caattgtcaa taaatcaagg cagactgcac tggacattgc tgtattttgg ggttataagc atatagctaa tttactagct actgctaaag gtgggaagaa gccttggttc ctaacgaatg aagtggaaga atgtgaaaat tattttagca aaacactact ggaccggaaa agtgaaaaga gaaataattc tgactggctg ctagctaaag aaagccatcc agccacagtt tttattcttt tctcagattt aaatcccttg gttactctag gtggcaataa agaaagtttc caacagccag aagttaggct ttgtcagctg aactacacag atataaagga ttatttggcc cagcctgaga agatcacctt gatttttctt ggagtagaac ttgaaataaa agacaaacta cttaattatg ctggtgaagt cccgagagag gaggaagatg gattggttgc ctggtttgct ctaggtatag atcctattgc tgctgaagaa ttcaagcaaa gacatgaaaa ttgttacttt cttcatcctc ctatgccagc ccttctgcaa ttgaaagaaa aagaagctgg ggttgtagct caagcaagat ctgttcttgc ctggcacagt cgatacaagt tttgcccaac ctgtggaaat gcaactaaaa ttgaagaagg tggctataag agattatgtt taaaagaaga ctgtcctagt ctcaatggcg tccataatac ctcataccca agagttgatc cagtagtaat catgcaagtt attcatccag atgggaccaa atgcctttta ggcaggcaga aaagatttcc cccaggcatg tttacttgcc ttgctggatt tattgagcct ggagagacaa tagaagatgc tgttaggaga gaagtagaag aggaaagtgg agtcaaagtt ggccatgttc agtatgttgc ttgtcaacca tggccaatgc cttcctcctt aatgattggt tgcttagctc tagcagtgtc tacagaaatt aaagttgaca agaatgaaat agaggatgcc cgctggttca ctagagaaca ggtcctggat gttctgacca aagggaagca gcaggcattc tttgtgccac caagccgagc tattgcacat caattaatca aacactggat tagaataaat cctaatctct aaatctaaga actaagcttt gagtattatt taataatttc taataacact cattcctcaa gtgatattag agattattca gtactcttga gagtgtcaca acacaaaata cgatgttggg ttttcgaaat attttcaaag tgttctgtct taatcacaaa ttcatatttt tacacatttt tacaatattg cctcagatta tgttaaattt gggtcagtct tctctgaact ttttctctct tggtttcttt tcttccttca cagttttatc tcacaaaacc atttttctaa taagagacat catgttggaa agatgttcta gaaatgtgca taaatttcag tgcctcttgt aagcattaaa ctgatgatga agaaagttcc tgatttgaga aatgaatcaa agtaatttta atgaattttt agcttgtatt agcttgagtt agctggcatt gattttttag tccttttgtt acctttaagt tgtcaatata tggtttttgt tcatctcccc attgtagtcc cacttgctct ttcctggggg ttccattgtt ctagcagtgg aggtgttata gtgtcgccac tcgtctaatt tgaccagtgt taagaatttt ctaatttaat aatttaatag tgatctcaat accacaccct catggaagga gaaaagcata ctattatatc tgggacctct cttttagacc taaaattaat taacatatct acttatatgt tacttatacc taaagctgtt attaagacaa accaagattc tctgcttttg cactgaaatt aaacttgaaa ggaattctcc tcaaaggtcg gatattaaat aagtcccagg cagatttaca tatttaattt aaaacattgg ctttatttca ttttgtgatg agtgatgtat ctgtgttaac aaaaaattgt ataatcatta ccaatactat ttattatgct caaatatatc ttggctttga ccttatttca acacattcta agaagccttg acaaagtaag tatattttag agctgaatca gtaagattct agagaaagca aaacatagta gttcacaatt ttgcaacata gaaagtcaca ttttgaaagg ctattttgaa attgatttaa tagctattat agtttatgaa tatcaaaatt tgtataattt gcatctttac taatgtatgc tagagctaca agagacctta aggataatat atgaaattag ctttccttat tttatagata aggaaaaaga aattgtgaaa ggtgaattta cctaattagt gaaagttaca taactaatta caacagtctg tactatataa tgcagaggac gattctccct gtaaaaggaa ctagaagcta ttactaaaaa tatatataga caaaattaaa agaaggaatg ataagaataa atttaattta ccaaatattg ttaattaaaa ttttagatac ttaacattta tttaacttaa ataaaagata actgtcagat aaaactttat tttactaatg agcagtgatt ttcttaggaa ttgatgaagg cttattggta tcaagaattt aaaccaaatt aaaactgaca gaggacattt agatacataa taaaattcga gctacataag tatatggaaa ataatgtacc ttgattatta tgaaatagag catcttgaaa ttcagtttta ctctaaatgt acttttaata cttgcagatt ctaagattac attgtaaaat tccaggtttt cataatgtta aaataggaaa gtagaatata aagtatcaac aagtgtagtt atacattttg ttttggatat ttaatcctta cttgggaaaa aatcagcatc taggtaaatt attattttaa taacaactct taaattgcca acctctgaga ggtgaaaagc tatgtaaata gaaggaatgg ccagttcaaa agaatagtag atgtgatagt gccgtgaatg tattctactg gaaatgaatg taataataca ttaaattttt aaaatcta"
    • description : "Homo sapiens nudix hydrolase 12 (NUDT12), transcript variant 1, mRNA."
    • organism
      • 0 : "Homo sapiens"
      • 1 : "Eukaryota"
      • 2 : "Metazoa"
      • 3 : "Chordata"
      • 4 : "Craniata"
      • 5 : "Vertebrata"
      • 6 : "Euteleostomi"
      • 7 : "Mammalia"
      • 8 : "Eutheria"
      • 9 : "Euarchontoglires"
      • 10 : "Primates"
      • 11 : "Haplorrhini"
      • 12 : "Catarrhini"
      • 13 : "Hominidae"
      • 14 : "Homo."
    • fragment :
  • authors
    • 0
      • primAcc : "NM_031438"
      • refno : 1
      • author : "Sahni N"
    • 1
      • primAcc : "NM_031438"
      • refno : 1
      • author : "Yi S"
    • 2
      • primAcc : "NM_031438"
      • refno : 1
      • author : "Taipale M"
    • 3
      • primAcc : "NM_031438"
      • refno : 1
      • author : "Fuxman Bass JI"
    • 4
      • primAcc : "NM_031438"
      • refno : 1
      • author : "Coulombe-Huntington J"
    • 5
      • primAcc : "NM_031438"
      • refno : 2
      • author : "Lopez S"
    • 6
      • primAcc : "NM_031438"
      • refno : 2
      • author : "Buil A"
    • 7
      • primAcc : "NM_031438"
      • refno : 2
      • author : "Souto JC"
    • 8
      • primAcc : "NM_031438"
      • refno : 2
      • author : "Casademont J"
    • 9
      • primAcc : "NM_031438"
      • refno : 2
      • author : "Martinez-Perez A"
    • 10
      • primAcc : "NM_031438"
      • refno : 2
      • author : "Almasy L"
    • 11
      • primAcc : "NM_031438"
      • refno : 2
      • author : "Soria JM"
    • 12
      • primAcc : "NM_031438"
      • refno : 3
      • author : "Xie T"
    • 13
      • primAcc : "NM_031438"
      • refno : 3
      • author : "Deng L"
    • 14
      • primAcc : "NM_031438"
      • refno : 3
      • author : "Mei P"
    • 15
      • primAcc : "NM_031438"
      • refno : 3
      • author : "Zhou Y"
    • 16
      • primAcc : "NM_031438"
      • refno : 3
      • author : "Wang B"
    • 17
      • primAcc : "NM_031438"
      • refno : 3
      • author : "Wei Y"
    • 18
      • primAcc : "NM_031438"
      • refno : 3
      • author : "Zhang X"
    • 19
      • primAcc : "NM_031438"
      • refno : 3
      • author : "Xu R"
    • 20
      • primAcc : "NM_031438"
      • refno : 4
      • author : "Del-Aguila JL"
    • 21
      • primAcc : "NM_031438"
      • refno : 4
      • author : "Beitelshees AL"
    • 22
      • primAcc : "NM_031438"
      • refno : 4
      • author : "Cooper-Dehoff RM"
    • 23
      • primAcc : "NM_031438"
      • refno : 5
      • author : "Hek K"
    • 24
      • primAcc : "NM_031438"
      • refno : 5
      • author : "Demirkan A"
    • 25
      • primAcc : "NM_031438"
      • refno : 5
      • author : "Teumer A"
    • 26
      • primAcc : "NM_031438"
      • refno : 5
      • author : "Cornelis MC"
    • 27
      • primAcc : "NM_031438"
      • refno : 5
      • author : "Amin N"
    • 28
      • primAcc : "NM_031438"
      • refno : 6
      • author : "Siedlinski M"
    • 29
      • primAcc : "NM_031438"
      • refno : 6
      • author : "Crapo JD"
    • 30
      • primAcc : "NM_031438"
      • refno : 6
      • author : "Silverman EK"
    • 31
      • primAcc : "NM_031438"
      • refno : 7
      • author : "Wang AG"
    • 32
      • primAcc : "NM_031438"
      • refno : 7
      • author : "Yoon SY"
    • 33
      • primAcc : "NM_031438"
      • refno : 7
      • author : "Oh JH"
    • 34
      • primAcc : "NM_031438"
      • refno : 7
      • author : "Jeon YJ"
    • 35
      • primAcc : "NM_031438"
      • refno : 7
      • author : "Kim M"
    • 36
      • primAcc : "NM_031438"
      • refno : 8
      • author : "Abdelraheim SR"
    • 37
      • primAcc : "NM_031438"
      • refno : 8
      • author : "Spiller DG"
    • 38
      • primAcc : "NM_031438"
      • refno : 8
      • author : "McLennan AG"
    • 39
      • primAcc : "NM_031438"
      • refno : 9
      • author : "Simpson JC"
    • 40
      • primAcc : "NM_031438"
      • refno : 9
      • author : "Wellenreuther R"
    • 41
      • primAcc : "NM_031438"
      • refno : 9
      • author : "Poustka A"
    • 42
      • primAcc : "NM_031438"
      • refno : 9
      • author : "Pepperkok R"
    • 43
      • primAcc : "NM_031438"
      • refno : 9
      • author : "Wiemann S"
  • gbSequence
    • primAcc : "NM_031438"
    • strands :
    • topology : "LINEAR"
    • division : "PRI"
    • segmentNo :
    • segmentCount :
    • version : "NM_031438.4"
    • ncbiGiId :
  • features
    • 0
      • primAcc : "NM_031438"
      • ftKey : "source"
      • ftQual : "organism"
      • ftValue : "Homo sapiens"
      • ftFrom : 1
      • ftTo : 3488
      • ftDesc : ""
    • 1
      • primAcc : "NM_031438"
      • ftKey : "source"
      • ftQual : "mol_type"
      • ftValue : "mRNA"
      • ftFrom : 1
      • ftTo : 3488
      • ftDesc : ""
    • 2
      • primAcc : "NM_031438"
      • ftKey : "source"
      • ftQual : "db_xref"
      • ftValue : "taxon:9606"
      • ftFrom : 1
      • ftTo : 3488
      • ftDesc : ""
    • 3
      • primAcc : "NM_031438"
      • ftKey : "source"
      • ftQual : "chromosome"
      • ftValue : "5"
      • ftFrom : 1
      • ftTo : 3488
      • ftDesc : ""
    • 4
      • primAcc : "NM_031438"
      • ftKey : "source"
      • ftQual : "map"
      • ftValue : "5q21.2"
      • ftFrom : 1
      • ftTo : 3488
      • ftDesc : ""
    • 5
      • primAcc : "NM_031438"
      • ftKey : "gene"
      • ftQual : "gene"
      • ftValue : "NUDT12"
      • ftFrom : 1
      • ftTo : 3488
      • ftDesc : ""
    • 6
      • primAcc : "NM_031438"
      • ftKey : "gene"
      • ftQual : "note"
      • ftValue : "nudix hydrolase 12"
      • ftFrom : 1
      • ftTo : 3488
      • ftDesc : ""
    • 7
      • primAcc : "NM_031438"
      • ftKey : "gene"
      • ftQual : "db_xref"
      • ftValue : "GeneID:83594"
      • ftFrom : 1
      • ftTo : 3488
      • ftDesc : ""
    • 8
      • primAcc : "NM_031438"
      • ftKey : "gene"
      • ftQual : "db_xref"
      • ftValue : "HGNC:HGNC:18826"
      • ftFrom : 1
      • ftTo : 3488
      • ftDesc : ""
    • 9
      • primAcc : "NM_031438"
      • ftKey : "gene"
      • ftQual : "db_xref"
      • ftValue : "MIM:609232"
      • ftFrom : 1
      • ftTo : 3488
      • ftDesc : ""
    • 10
      • primAcc : "NM_031438"
      • ftKey : "exon"
      • ftQual : "gene"
      • ftValue : "NUDT12"
      • ftFrom : 1
      • ftTo : 87
      • ftDesc : ""
    • 11
      • primAcc : "NM_031438"
      • ftKey : "exon"
      • ftQual : "inference"
      • ftValue : "alignment:Splign:2.1.0"
      • ftFrom : 1
      • ftTo : 87
      • ftDesc : ""
    • 12
      • primAcc : "NM_031438"
      • ftKey : "exon"
      • ftQual : "gene"
      • ftValue : "NUDT12"
      • ftFrom : 88
      • ftTo : 299
      • ftDesc : ""
    • 13
      • primAcc : "NM_031438"
      • ftKey : "exon"
      • ftQual : "inference"
      • ftValue : "alignment:Splign:2.1.0"
      • ftFrom : 88
      • ftTo : 299
      • ftDesc : ""
    • 14
      • primAcc : "NM_031438"
      • ftKey : "CDS"
      • ftQual : "gene"
      • ftValue : "NUDT12"
      • ftFrom : 94
      • ftTo : 1482
      • ftDesc : ""
    • 15
      • primAcc : "NM_031438"
      • ftKey : "CDS"
      • ftQual : "EC_number"
      • ftValue : "3.6.1.22"
      • ftFrom : 94
      • ftTo : 1482
      • ftDesc : ""
    • 16
      • primAcc : "NM_031438"
      • ftKey : "CDS"
      • ftQual : "note"
      • ftValue : "isoform 1 is encoded by transcript variant 1; nucleoside diphosphate linked moiety X-type motif 12; peroxisomal NADH pyrophosphatase NUDT12; nudix motif 12; nucleoside diphosphate-linked moiety X motif 12; nudix (nucleoside diphosphate linked moiety X)-type motif 12"
      • ftFrom : 94
      • ftTo : 1482
      • ftDesc : ""
    • 17
      • primAcc : "NM_031438"
      • ftKey : "CDS"
      • ftQual : "codon_start"
      • ftValue : "1"
      • ftFrom : 94
      • ftTo : 1482
      • ftDesc : ""
    • 18
      • primAcc : "NM_031438"
      • ftKey : "CDS"
      • ftQual : "product"
      • ftValue : "peroxisomal NADH pyrophosphatase NUDT12 isoform 1"
      • ftFrom : 94
      • ftTo : 1482
      • ftDesc : ""
    • 19
      • primAcc : "NM_031438"
      • ftKey : "CDS"
      • ftQual : "protein_id"
      • ftValue : "NP_113626.1"
      • ftFrom : 94
      • ftTo : 1482
      • ftDesc : ""
    • 20
      • primAcc : "NM_031438"
      • ftKey : "CDS"
      • ftQual : "db_xref"
      • ftValue : "CCDS:CCDS4096.1"
      • ftFrom : 94
      • ftTo : 1482
      • ftDesc : ""
    • 21
      • primAcc : "NM_031438"
      • ftKey : "CDS"
      • ftQual : "db_xref"
      • ftValue : "GeneID:83594"
      • ftFrom : 94
      • ftTo : 1482
      • ftDesc : ""
    • 22
      • primAcc : "NM_031438"
      • ftKey : "CDS"
      • ftQual : "db_xref"
      • ftValue : "HGNC:HGNC:18826"
      • ftFrom : 94
      • ftTo : 1482
      • ftDesc : ""
    • 23
      • primAcc : "NM_031438"
      • ftKey : "CDS"
      • ftQual : "db_xref"
      • ftValue : "MIM:609232"
      • ftFrom : 94
      • ftTo : 1482
      • ftDesc : ""
    • 24
      • primAcc : "NM_031438"
      • ftKey : "CDS"
      • ftQual : "translation"
      • ftValue : "MSSVKRSLKQEIVTQFHCSAAEGDIAKLTGILSHSPSLLNETSE NGWTALMYAARNGHPEIVQFLLEKGCDRSIVNKSRQTALDIAVFWGYKHIANLLATAK GGKKPWFLTNEVEECENYFSKTLLDRKSEKRNNSDWLLAKESHPATVFILFSDLNPLV TLGGNKESFQQPEVRLCQLNYTDIKDYLAQPEKITLIFLGVELEIKDKLLNYAGEVPR EEEDGLVAWFALGIDPIAAEEFKQRHENCYFLHPPMPALLQLKEKEAGVVAQARSVLA WHSRYKFCPTCGNATKIEEGGYKRLCLKEDCPSLNGVHNTSYPRVDPVVIMQVIHPDG TKCLLGRQKRFPPGMFTCLAGFIEPGETIEDAVRREVEEESGVKVGHVQYVACQPWPM PSSLMIGCLALAVSTEIKVDKNEIEDARWFTREQVLDVLTKGKQQAFFVPPSRAIAHQ LIKHWIRINPNL"
      • ftFrom : 94
      • ftTo : 1482
      • ftDesc : ""
    • 25
      • primAcc : "NM_031438"
      • ftKey : "misc_feature"
      • ftQual : "gene"
      • ftValue : "NUDT12"
      • ftFrom : 124
      • ftTo : 213
      • ftDesc : ""
    • 26
      • primAcc : "NM_031438"
      • ftKey : "misc_feature"
      • ftQual : "experiment"
      • ftValue : "experimental evidence, no additional details recorded"
      • ftFrom : 124
      • ftTo : 213
      • ftDesc : ""
    • 27
      • primAcc : "NM_031438"
      • ftKey : "misc_feature"
      • ftQual : "note"
      • ftValue : "propagated from UniProtKBSwiss-Prot (Q9BQG2.1); Region: ANK 1"
      • ftFrom : 124
      • ftTo : 213
      • ftDesc : ""
    • 28
      • primAcc : "NM_031438"
      • ftKey : "misc_feature"
      • ftQual : "gene"
      • ftValue : "NUDT12"
      • ftFrom : 226
      • ftTo : 315
      • ftDesc : ""
    • 29
      • primAcc : "NM_031438"
      • ftKey : "misc_feature"
      • ftQual : "experiment"
      • ftValue : "experimental evidence, no additional details recorded"
      • ftFrom : 226
      • ftTo : 315
      • ftDesc : ""
    • 30
      • primAcc : "NM_031438"
      • ftKey : "misc_feature"
      • ftQual : "note"
      • ftValue : "propagated from UniProtKBSwiss-Prot (Q9BQG2.1); Region: ANK 2"
      • ftFrom : 226
      • ftTo : 315
      • ftDesc : ""
    • 31
      • primAcc : "NM_031438"
      • ftKey : "misc_feature"
      • ftQual : "gene"
      • ftValue : "NUDT12"
      • ftFrom : 325
      • ftTo : 387
      • ftDesc : ""
    • 32
      • primAcc : "NM_031438"
      • ftKey : "misc_feature"
      • ftQual : "experiment"
      • ftValue : "experimental evidence, no additional details recorded"
      • ftFrom : 325
      • ftTo : 387
      • ftDesc : ""
    • 33
      • primAcc : "NM_031438"
      • ftKey : "misc_feature"
      • ftQual : "note"
      • ftValue : "propagated from UniProtKBSwiss-Prot (Q9BQG2.1); Region: ANK 3"
      • ftFrom : 325
      • ftTo : 387
      • ftDesc : ""
    • 34
      • primAcc : "NM_031438"
      • ftKey : "misc_feature"
      • ftQual : "gene"
      • ftValue : "NUDT12"
      • ftFrom : 646
      • ftTo : 648
      • ftDesc : ""
    • 35
      • primAcc : "NM_031438"
      • ftKey : "misc_feature"
      • ftQual : "experiment"
      • ftValue : "experimental evidence, no additional details recorded"
      • ftFrom : 646
      • ftTo : 648
      • ftDesc : ""
    • 36
      • primAcc : "NM_031438"
      • ftKey : "misc_feature"
      • ftQual : "note"
      • ftValue : "N6-succinyllysine. {ECO:0000250|UniProtKB:Q9DCN1}; propagated from UniProtKBSwiss-Prot (Q9BQG2.1); modified site"
      • ftFrom : 646
      • ftTo : 648
      • ftDesc : ""
    • 37
      • primAcc : "NM_031438"
      • ftKey : "misc_feature"
      • ftQual : "gene"
      • ftValue : "NUDT12"
      • ftFrom : 967
      • ftTo : 969
      • ftDesc : ""
    • 38
      • primAcc : "NM_031438"
      • ftKey : "misc_feature"
      • ftQual : "experiment"
      • ftValue : "experimental evidence, no additional details recorded"
      • ftFrom : 967
      • ftTo : 969
      • ftDesc : ""
    • 39
      • primAcc : "NM_031438"
      • ftKey : "misc_feature"
      • ftQual : "note"
      • ftValue : "N6-succinyllysine. {ECO:0000250|UniProtKB:Q9DCN1}; propagated from UniProtKBSwiss-Prot (Q9BQG2.1); modified site"
      • ftFrom : 967
      • ftTo : 969
      • ftDesc : ""
    • 40
      • primAcc : "NM_031438"
      • ftKey : "misc_feature"
      • ftQual : "gene"
      • ftValue : "NUDT12"
      • ftFrom : 1156
      • ftTo : 1221
      • ftDesc : ""
    • 41
      • primAcc : "NM_031438"
      • ftKey : "misc_feature"
      • ftQual : "experiment"
      • ftValue : "experimental evidence, no additional details recorded"
      • ftFrom : 1156
      • ftTo : 1221
      • ftDesc : ""
    • 42
      • primAcc : "NM_031438"
      • ftKey : "misc_feature"
      • ftQual : "note"
      • ftValue : "propagated from UniProtKBSwiss-Prot (Q9BQG2.1); Region: Nudix box"
      • ftFrom : 1156
      • ftTo : 1221
      • ftDesc : ""
    • 43
      • primAcc : "NM_031438"
      • ftKey : "misc_feature"
      • ftQual : "gene"
      • ftValue : "NUDT12"
      • ftFrom : 1471
      • ftTo : 1479
      • ftDesc : ""
    • 44
      • primAcc : "NM_031438"
      • ftKey : "misc_feature"
      • ftQual : "experiment"
      • ftValue : "experimental evidence, no additional details recorded"
      • ftFrom : 1471
      • ftTo : 1479
      • ftDesc : ""
    • 45
      • primAcc : "NM_031438"
      • ftKey : "misc_feature"
      • ftQual : "note"
      • ftValue : "propagated from UniProtKBSwiss-Prot (Q9BQG2.1); Region: Microbody targeting signal. {ECO:0000305}"
      • ftFrom : 1471
      • ftTo : 1479
      • ftDesc : ""
    • 46
      • primAcc : "NM_031438"
      • ftKey : "exon"
      • ftQual : "gene"
      • ftValue : "NUDT12"
      • ftFrom : 300
      • ftTo : 889
      • ftDesc : ""
    • 47
      • primAcc : "NM_031438"
      • ftKey : "exon"
      • ftQual : "inference"
      • ftValue : "alignment:Splign:2.1.0"
      • ftFrom : 300
      • ftTo : 889
      • ftDesc : ""
    • 48
      • primAcc : "NM_031438"
      • ftKey : "exon"
      • ftQual : "gene"
      • ftValue : "NUDT12"
      • ftFrom : 890
      • ftTo : 1057
      • ftDesc : ""
    • 49
      • primAcc : "NM_031438"
      • ftKey : "exon"
      • ftQual : "inference"
      • ftValue : "alignment:Splign:2.1.0"
      • ftFrom : 890
      • ftTo : 1057
      • ftDesc : ""
    • 50
      • primAcc : "NM_031438"
      • ftKey : "exon"
      • ftQual : "gene"
      • ftValue : "NUDT12"
      • ftFrom : 1058
      • ftTo : 1171
      • ftDesc : ""
    • 51
      • primAcc : "NM_031438"
      • ftKey : "exon"
      • ftQual : "inference"
      • ftValue : "alignment:Splign:2.1.0"
      • ftFrom : 1058
      • ftTo : 1171
      • ftDesc : ""
    • 52
      • primAcc : "NM_031438"
      • ftKey : "exon"
      • ftQual : "gene"
      • ftValue : "NUDT12"
      • ftFrom : 1172
      • ftTo : 1371
      • ftDesc : ""
    • 53
      • primAcc : "NM_031438"
      • ftKey : "exon"
      • ftQual : "inference"
      • ftValue : "alignment:Splign:2.1.0"
      • ftFrom : 1172
      • ftTo : 1371
      • ftDesc : ""
    • 54
      • primAcc : "NM_031438"
      • ftKey : "exon"
      • ftQual : "gene"
      • ftValue : "NUDT12"
      • ftFrom : 1372
      • ftTo : 3488
      • ftDesc : ""
    • 55
      • primAcc : "NM_031438"
      • ftKey : "exon"
      • ftQual : "inference"
      • ftValue : "alignment:Splign:2.1.0"
      • ftFrom : 1372
      • ftTo : 3488
      • ftDesc : ""
  • keywords
    • 0
      • primAcc : "NM_031438"
      • keywords : "RefSeq."
  • references
    • 0
      • primAcc : "NM_031438"
      • refno : 1
      • baseRange : "1 to 3488"
      • title : "Widespread macromolecular interaction perturbations in human genetic disorders"
      • journal : "Cell 161 (3), 647-660 (2015)"
      • medline :
      • pubmed : "25910212"
      • remark :
      • comments :
    • 1
      • primAcc : "NM_031438"
      • refno : 2
      • baseRange : "1 to 3488"
      • title : "A genome-wide association study in the genetic analysis of idiopathic thrombophilia project suggests sex-specific regulation of mitochondrial DNA levels"
      • journal : "Mitochondrion 18, 34-40 (2014)"
      • medline :
      • pubmed : "25240745"
      • remark :
      • comments :
    • 2
      • primAcc : "NM_031438"
      • refno : 3
      • baseRange : "1 to 3488"
      • title : "Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations"
      • journal : "Neurobiol. Aging 35 (7), 1778 (2014)"
      • medline :
      • pubmed : "24529757"
      • remark :
      • comments :
    • 3
      • primAcc : "NM_031438"
      • refno : 4
      • baseRange : "1 to 3488"
      • title : "Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans"
      • journal : "Pharmacogenomics J. 14 (1), 35-40 (2014)"
      • medline :
      • pubmed : "23400010"
      • remark :
      • comments :
    • 4
      • primAcc : "NM_031438"
      • refno : 5
      • baseRange : "1 to 3488"
      • title : "A genome-wide association study of depressive symptoms"
      • journal : "Biol. Psychiatry 73 (7), 667-678 (2013)"
      • medline :
      • pubmed : "23290196"
      • remark :
      • comments :
    • 5
      • primAcc : "NM_031438"
      • refno : 6
      • baseRange : "1 to 3488"
      • title : "Genome-wide association study of smoking behaviours in patients with COPD"
      • journal : "Thorax 66 (10), 894-902 (2011)"
      • medline :
      • pubmed : "21685187"
      • remark :
      • comments :
    • 6
      • primAcc : "NM_031438"
      • refno : 7
      • baseRange : "1 to 3488"
      • title : "Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags"
      • journal : "Biochem. Biophys. Res. Commun. 345 (3), 1022-1032 (2006)"
      • medline :
      • pubmed : "16712791"
      • remark :
      • comments :
    • 7
      • primAcc : "NM_031438"
      • refno : 8
      • baseRange : "1 to 3488"
      • title : "Mammalian NADH diphosphatases of the Nudix family: cloning and characterization of the human peroxisomal NUDT12 protein"
      • journal : "Biochem. J. 374 (Pt 2), 329-335 (2003)"
      • medline :
      • pubmed : "12790796"
      • remark : "GeneRIF: NUDT12 may act to regulate the concentration of peroxisomal nicotinamide nucleotide cofactors required for oxidative metabolism in this organelle."
      • comments :
    • 8
      • primAcc : "NM_031438"
      • refno : 9
      • baseRange : "1 to 3488"
      • title : "Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing"
      • journal : "EMBO Rep. 1 (3), 287-292 (2000)"
      • medline :
      • pubmed : "11256614"
      • remark :
      • comments :
  • srcForm
    • primAcc : ""
    • entry : ""
  • spDatabank